General Information

    • DRAMP ID

    • DRAMP03317

    • Peptide Name

    • Cathelicidin-related antimicrobial peptide (AMPs)

    • Source

    • Chinchilla lanigera (Long-tailed chinchilla) (Chinchilla villidera)

    • Family

    • Not found

    • Gene

    • CRAMP

    • Sequence

    • AKRGGFWRKVGRKLGKGIRKIGKTIKSQLGKFRPRLQYRYQF

    • Sequence Length

    • 42

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli, Moraxella catarrhalis 1857;
      • Gram-positive bacterium: Streptococcus pneumoniae serotype 14.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03317 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03317.

Physicochemical Information

    • Formula

    • C231H381N75O50

    • Absent Amino Acids

    • CDEHMN

    • Common Amino Acids

    • K

    • Mass

    • 5009.04

    • PI

    • 12.14

    • Basic Residues

    • 15

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +15

    • Boman Index

    • -118.49

    • Hydrophobicity

    • -1.031

    • Aliphatic Index

    • 65

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8480

    • Absorbance 280nm

    • 206.83

    • Polar Residues

    • 11

DRAMP03317

DRAMP03317 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • A member of the cathelicidin family of antimicrobial peptides is produced in the upper airway of the chinchilla and its mRNA expression is altered by common viral and bacterial co-pathogens of otitis media.

    • Reference

    • Mol Immunol. 2007 Mar;44(9):2446-2458.

    • Author

    • McGillivary G, Ray WC, Bevins CL, Munson RS Jr, Bakaletz LO.