General Information

    • DRAMP ID

    • DRAMP03325

    • Peptide Name

    • Hepcidin antimicrobial peptide 2

    • Source

    • Mus musculus (Mouse)

    • Family

    • Not found

    • Gene

    • Hamp2

    • Sequence

    • QMRQTTELQPLHGEESRADIAIPMQKRRKRDINFPICRFCCQCCNKPSCGICCE

    • Sequence Length

    • 54

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03325 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03325.

Physicochemical Information

    • Formula

    • C259H428N84O78S10

    • Absent Amino Acids

    • VWY

    • Common Amino Acids

    • C

    • Mass

    • 6287.36

    • PI

    • 8.52

    • Basic Residues

    • 10

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +4

    • Boman Index

    • -147.59

    • Hydrophobicity

    • -0.639

    • Aliphatic Index

    • 54.26

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 500

    • Absorbance 280nm

    • 9.43

    • Polar Residues

    • 16

DRAMP03325

DRAMP03325 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Lineage-specific biology revealed by a finished genome assembly of the mouse.

    • Reference

    • PLoS Biol. 2009 May 5;7(5):e1000112.

    • Author

    • Lineage-specific biology revealed by a finished genome assembly of the mouse.