General Information

    • DRAMP ID

    • DRAMP03332

    • Peptide Name

    • Alpha-defensin cryptdin-4 (Defensin-related cryptdin4; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the alpha-defensin family

    • Gene

    • Defa4

    • Sequence

    • LRGLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR

    • Sequence Length

    • 34

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacterium: Listeria monocytogenes EGD;
      • Gram-negative bacteria: Escherichia coli ML-35p, mouse-avirulent Salmonella typhimurium 7953.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Phospholipid

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys6 and Cys31,Cys8 and Cys23,Cys13 and Cys30.

    • Stereochemistry

    • L

    • Structure

    • Beta strand (3 strands; 18 residues)

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03332 helical wheel diagram
  • 2GW9-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP03332.

Physicochemical Information

    • Formula

    • C170H286N62O40S6

    • Absent Amino Acids

    • ADMNQSW

    • Common Amino Acids

    • R

    • Mass

    • 4030.89

    • PI

    • 10.13

    • Basic Residues

    • 11

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +10

    • Boman Index

    • -100.78

    • Hydrophobicity

    • -0.462

    • Aliphatic Index

    • 65.88

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 101.67

    • Polar Residues

    • 14

DRAMP03332

DRAMP03332 chydropathy plot

Comments Information

    • Function

    • Probably contributes to the antimicrobial barrier Function

    • Tissue specificity

    • Paneth cells of the small bowel.

    • PTM

    • Contains three disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Solution structure of cryptdin-4, a mouse paneth cell alpha-defensin.

    • Reference

    • Biochemistry. 2004 Dec 21;43(50):15759-15766.

    • Author

    • Jing W, Hunter HN, Tanabe H, Ouellette AJ, Vogel HJ.
  • ·Literature 2

    • Title

    • Mouse Paneth cell defensins: primary structures and antibacterial activities of numerous cryptdin isoforms.

    • Reference

    • Infect Immun. 1994 Nov;62(11):5040-5047.

    • Author

    • Ouellette AJ, Hsieh MM, Nosek MT, Cano-Gauci DF, Huttner KM, Buick RN, Selsted ME.
  • ·Literature 3

    • Title

    • Structural and functional characterization of the conserved salt bridge in mammalian paneth cell alpha-defensins: solution structures of mouse CRYPTDIN-4 and (E15D)-CRYPTDIN-4.

    • Reference

    • J Biol Chem. 2006 Sep 22;281(38):28068-78.

    • Author

    • Rosengren KJ, Daly NL, Fornander LM, Jönsson LM, Shirafuji Y, Qu X, Vogel HJ, Ouellette AJ, Craik DJ.