• DRAMP ID

    • DRAMP03332
    • Peptide Name

    • Alpha-defensin cryptdin-4 (Defensin-related cryptdin4; Rodents, mammals, animals)
    • Source

    • Mus musculus (Mouse)
    • Family

    • Belongs to the alpha-defensin family
    • Gene

    • Defa4
    • Sequence

    • LRGLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
    • Sequence Length

    • 34
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-positive bacterium: Listeria monocytogenes EGD;
      • Gram-negative bacteria: Escherichia coli ML-35p, mouse-avirulent Salmonella typhimurium 7953.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Phospholipid
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys6 and Cys31,Cys8 and Cys23,Cys13 and Cys30.
    • Stereochemistry

    • L
    • Structure

    • Beta strand (3 strands; 18 residues)
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03332 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP03332.
    • Formula

    • C170H286N62O40S6
    • Absent Amino Acids

    • ADMNQSW
    • Common Amino Acids

    • R
    • Mass

    • 4030.89
    • PI

    • 10.13
    • Basic Residues

    • 11
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +10
    • Boman Index

    • -100.78
    • Hydrophobicity

    • -0.462
    • Aliphatic Index

    • 65.88
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 101.67
    • Polar Residues

    • 14

DRAMP03332

DRAMP03332 chydropathy plot
    • Function

    • Probably contributes to the antimicrobial barrier Function
    • Tissue specificity

    • Paneth cells of the small bowel.
    • PTM

    • Contains three disulfide bonds.
  • ·Literature 1
    • Title

    • Solution structure of cryptdin-4, a mouse paneth cell alpha-defensin.
    • Reference

    • Biochemistry. 2004 Dec 21;43(50):15759-15766.
    • Author

    • Jing W, Hunter HN, Tanabe H, Ouellette AJ, Vogel HJ.
  • ·Literature 2
    • Title

    • Mouse Paneth cell defensins: primary structures and antibacterial activities of numerous cryptdin isoforms.
    • Reference

    • Infect Immun. 1994 Nov;62(11):5040-5047.
    • Author

    • Ouellette AJ, Hsieh MM, Nosek MT, Cano-Gauci DF, Huttner KM, Buick RN, Selsted ME.
  • ·Literature 3
    • Title

    • Structural and functional characterization of the conserved salt bridge in mammalian paneth cell alpha-defensins: solution structures of mouse CRYPTDIN-4 and (E15D)-CRYPTDIN-4.
    • Reference

    • J Biol Chem. 2006 Sep 22;281(38):28068-78.
    • Author

    • Rosengren KJ, Daly NL, Fornander LM, Jönsson LM, Shirafuji Y, Qu X, Vogel HJ, Ouellette AJ, Craik DJ.