General Information

    • DRAMP ID

    • DRAMP03345

    • Peptide Name

    • Alpha-defensin cryptdin-20 (Defensin-related cryptdin-20; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the alpha-defensin family

    • Gene

    • Defa20

    • Sequence

    • SRDLICYCRKGGCNRGEQVYGTCSGRLLYCCPRR

    • Sequence Length

    • 34

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03345 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03345.

Physicochemical Information

    • Formula

    • C159H261N55O47S6

    • Absent Amino Acids

    • AFHMW

    • Common Amino Acids

    • CR

    • Mass

    • 3887.52

    • PI

    • 9.15

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 5

    • Net Charge

    • +5

    • Boman Index

    • -96.47

    • Hydrophobicity

    • -0.577

    • Aliphatic Index

    • 54.41

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 146.82

    • Polar Residues

    • 18

DRAMP03345

DRAMP03345 chydropathy plot

Comments Information

    • Function

    • May have microbicidal activities (By similarity).

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Unknown

    • Reference

    • Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases

    • Author

    • Chen B, Zha Y, Xu X, Deng X.