General Information

    • DRAMP ID

    • DRAMP03352

    • Peptide Name

    • Alpha-defensin-related sequence 1 (Defensin-related cryptdin 1; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the alpha-defensin family

    • Gene

    • Defa-rs1

    • Sequence

    • RFPWCRKCRVCQKCQVCQKCPVCPTCPQCPKQPLCEERQNKTAITTQAPNTQHKGC

    • Sequence Length

    • 56

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03352 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03352.

Physicochemical Information

    • Formula

    • C267H439N87O76S11

    • Absent Amino Acids

    • DMSY

    • Common Amino Acids

    • C

    • Mass

    • 6436.62

    • PI

    • 9.13

    • Basic Residues

    • 11

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +9

    • Boman Index

    • -135.8

    • Hydrophobicity

    • -0.854

    • Aliphatic Index

    • 33.04

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6125

    • Absorbance 280nm

    • 111.36

    • Polar Residues

    • 19

DRAMP03352

DRAMP03352 chydropathy plot

Comments Information

    • Function

    • Apparent precursor of a secreted, cationic, proline- and cysteine-rich peptide that contains Cys-Pro-Xaa repeats. Unlike cryptdin, the proposed mature peptide region lacks the structural motif characteristic of defensins. It may have microbicidal activit.

    • Developmental stage

    • Accumulates to high levels in intestinal crypt epithelium during postnatal development.

Literature Information

  • ·Literature 1

    • Title

    • A novel mouse gene family coding for cationic, cysteine-rich peptides. Regulation in small intestine and cells of myeloid origin.

    • Reference

    • J Biol Chem. 1990 Jun 15;265(17):9831-9837.

    • Author

    • Ouellette AJ, Lualdi JC.
  • ·Literature 2

    • Title

    • A novel gene family coding for cationic, cysteine-rich peptides. Regulation in mouse small intestine and cells of myeloid origin.

    • Reference

    • J Biol Chem. 1994 Jul 15;269(28):18702.

    • Author

    • Ouellette AJ, Lauldi J.