• DRAMP ID

    • DRAMP03358
    • Peptide Name

    • Cryptdin related sequence peptide (CRS4C-1d; Rodents, mammals, animals)
    • Source

    • Mus musculus (Mouse)
    • Family

    • Not found
    • Gene

    • Defa-rs4
    • Sequence

    • LQDAAVGWGRRCPQCPRCPSCPSCPRCPRCPRCKCNPK
    • Sequence Length

    • 38
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-negative bacterium: Salmonella typhimurium ATCC 14028;
      • Gram-positive bacteria: Enterococcus faecalis, Listeria monocytogenes type 1 clinical isolate, Streptococcus pyogenes clinical isolate.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Lipopolysaccharide (LPS)-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03358 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03358.
    • Formula

    • C171H282N62O46S9
    • Absent Amino Acids

    • EFHIMTY
    • Common Amino Acids

    • C
    • Mass

    • 4231.05
    • PI

    • 9.24
    • Basic Residues

    • 8
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 5
    • Net Charge

    • +7
    • Boman Index

    • -105.55
    • Hydrophobicity

    • -0.811
    • Aliphatic Index

    • 23.16
    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 6000
    • Absorbance 280nm

    • 162.16
    • Polar Residues

    • 14

DRAMP03358

DRAMP03358 chydropathy plot
    • Function

    • Antimicrobial peptide that defense response to Gram-negative bacterium and Gram-positive bacterium.
    • MOA

    • CRS peptides were able to bind LPS and to reduce its immunostimulatory activity, leading to a substantial reduction in cellular activation.
  • ·Literature 1
    • Title

    • Increased diversity of intestinal antimicrobial peptides by covalent dimer formation.
    • Reference

    • Nat Immunol. 2004 Aug;5(8):836-843.
    • Author

    • Hornef MW, Pütsep K, Karlsson J, Refai E, Andersson M.