General Information

    • DRAMP ID

    • DRAMP03358

    • Peptide Name

    • Cryptdin related sequence peptide (CRS4C-1d; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Not found

    • Gene

    • Defa-rs4

    • Sequence

    • LQDAAVGWGRRCPQCPRCPSCPSCPRCPRCPRCKCNPK

    • Sequence Length

    • 38

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Salmonella typhimurium ATCC 14028;
      • Gram-positive bacteria: Enterococcus faecalis, Listeria monocytogenes type 1 clinical isolate, Streptococcus pyogenes clinical isolate.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipopolysaccharide (LPS)-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03358 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03358.

Physicochemical Information

    • Formula

    • C171H282N62O46S9

    • Absent Amino Acids

    • EFHIMTY

    • Common Amino Acids

    • C

    • Mass

    • 4231.05

    • PI

    • 9.24

    • Basic Residues

    • 8

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 5

    • Net Charge

    • +7

    • Boman Index

    • -105.55

    • Hydrophobicity

    • -0.811

    • Aliphatic Index

    • 23.16

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6000

    • Absorbance 280nm

    • 162.16

    • Polar Residues

    • 14

DRAMP03358

DRAMP03358 chydropathy plot

Comments Information

    • Function

    • Antimicrobial peptide that defense response to Gram-negative bacterium and Gram-positive bacterium.

    • MOA

    • CRS peptides were able to bind LPS and to reduce its immunostimulatory activity, leading to a substantial reduction in cellular activation.

Literature Information

  • ·Literature 1

    • Title

    • Increased diversity of intestinal antimicrobial peptides by covalent dimer formation.

    • Reference

    • Nat Immunol. 2004 Aug;5(8):836-843.

    • Author

    • Hornef MW, Pütsep K, Karlsson J, Refai E, Andersson M.