General Information

    • DRAMP ID

    • DRAMP03366

    • Peptide Name

    • Beta-defensin 1 (BD-1; mBD-1; Defensin, beta 1; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Not found

    • Sequence

    • DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS

    • Sequence Length

    • 37

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-negative bacteria: Escherichia coli, Pseudomonas aeruginosa;
      • Gram-positive bacterium: Staphylococcus aureus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03366 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03366.

Physicochemical Information

    • Formula

    • C168H272N52O54S6

    • Absent Amino Acids

    • AEIMVW

    • Common Amino Acids

    • C

    • Mass

    • 4076.68

    • PI

    • 8.89

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 4

    • Net Charge

    • +5

    • Boman Index

    • -85.31

    • Hydrophobicity

    • -0.93

    • Aliphatic Index

    • 31.62

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 51.81

    • Polar Residues

    • 18

DRAMP03366

DRAMP03366 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 5-34; 12-27; 17-35.

Literature Information

  • ·Literature 1

    • Title

    • The mouse genome encodes a single homolog of the antimicrobial peptide human beta-defensin 1.

    • Reference

    • FEBS Lett. 1997 Aug 11;413(1):45-49.

    • Author

    • Huttner KM, Kozak CA, Bevins CL.