General Information

    • DRAMP ID

    • DRAMP03367

    • Peptide Name

    • Beta-defensin 2 (BD-2, mBD-2; Defensin, beta 2; Defb2; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb2

    • Sequence

    • AVGSLKSIGYEAELDHCHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYMK

    • Sequence Length

    • 51

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03367 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03367.

Physicochemical Information

    • Formula

    • C237H372N70O70S7

    • Absent Amino Acids

    • QW

    • Common Amino Acids

    • CGP

    • Mass

    • 5546.41

    • PI

    • 8.63

    • Basic Residues

    • 9

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +5

    • Boman Index

    • -82.59

    • Hydrophobicity

    • -0.439

    • Aliphatic Index

    • 49.8

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 96.9

    • Polar Residues

    • 21

DRAMP03367

DRAMP03367 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 17-46; 24-39; 29-47.

    • Tissue specificity

    • Kidney, uterus and to a lesser extent in heart.

    • Induction

    • In tracheal epithelium, by lipopolysaccharide or inflammation.

Literature Information

  • ·Literature 1

    • Title

    • A novel mouse beta defensin, Defb2, which is upregulated in the airways by lipopolysaccharide.

    • Reference

    • FEBS Lett. 1999 Jan 8;442(1):112-116.

    • Author

    • Morrison GM, Davidson DJ, Dorin JR.