General Information

    • DRAMP ID

    • DRAMP03368

    • Peptide Name

    • Beta-defensin 3 (BD-3, mBD-3; Defensin, beta 3; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb3

    • Sequence

    • KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK

    • Sequence Length

    • 41

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli, Pseudomonas aeruginosa.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys9 and Cys37,Cys17 and Cys30,Cys20 and Cys38.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03368 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03368.

Physicochemical Information

    • Formula

    • C195H334N68O50S6

    • Absent Amino Acids

    • ADEHMY

    • Common Amino Acids

    • CK

    • Mass

    • 4623.58

    • PI

    • 10.35

    • Basic Residues

    • 11

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +11

    • Boman Index

    • -99

    • Hydrophobicity

    • -0.598

    • Aliphatic Index

    • 61.71

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 146.88

    • Polar Residues

    • 18

DRAMP03368

DRAMP03368 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 9-37; 17-30; 20-38. Highest expression in salivary glands, epididymis, ovary and pancreas and to a lesser extent in lung, liver and brain. Low or no expression in skeletal muscle and tongue. By bacterial infection.

Literature Information

  • ·Literature 1

    • Title

    • Mouse beta-defensin 3 is an inducible antimicrobial peptide expressed in the epithelia of multiple organs.

    • Reference

    • Infect Immun. 1999 Jul;67(7):3542-3547.

    • Author

    • Bals R, Wang X, Meegalla R.L, Wattler S, Weiner D.J, Nehls M.C, Wilson J.M.