General Information

    • DRAMP ID

    • DRAMP03370

    • Peptide Name

    • Beta-defensin 6 (BD-6, mBD-6; Defensin, beta 6; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb6

    • Sequence

    • QLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK

    • Sequence Length

    • 41

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli ATCC 25922 (MIC=20 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys9 and Cys37,Cys16 and Cys30,Cys20 and Cys38.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03370 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C182H300N66O52S7

    • Absent Amino Acids

    • ADEW

    • Common Amino Acids

    • G

    • Mass

    • 4469.21

    • PI

    • 9.69

    • Basic Residues

    • 9

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +9

    • Boman Index

    • -92.38

    • Hydrophobicity

    • -0.522

    • Aliphatic Index

    • 45.12

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 46.63

    • Polar Residues

    • 21

DRAMP03370

DRAMP03370 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 9-37; 16-30; 20-38.

    • Predominantly expressed in skeletal muscle, also expressed in esophagus, tongue, and trachea. Also expressed in lung when induced by lipopolysaccharide. Expressed constitutively and induced by lipopolysaccharide (LPS).

Literature Information

  • ·Literature 1

    • Title

    • A novel mouse beta-defensin, mBD-6, predominantly expressed in skeletal muscle.

    • Reference

    • J Biol Chem. 2001 Aug 24;276(34):31510-31514.

    • Author

    • Yamaguchi Y, Fukuhara S, Nagase T, Tomita T, Hitomi S, Kimura S, Kurihara H, Ouchi Y.