• DRAMP ID

    • DRAMP03370
    • Peptide Name

    • Beta-defensin 6 (BD-6, mBD-6; Defensin, beta 6; Rodents, mammals, animals)
    • Source

    • Mus musculus (Mouse)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Defb6
    • Sequence

    • QLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK
    • Sequence Length

    • 41
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-
    • Target Organism

      • Gram-negative bacterium: Escherichia coli ATCC 25922 (MIC=20 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys9 and Cys37,Cys16 and Cys30,Cys20 and Cys38.
    • Stereochemistry

    • L
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03370 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03370.
    • Formula

    • C182H300N66O52S7
    • Absent Amino Acids

    • ADEW
    • Common Amino Acids

    • G
    • Mass

    • 4469.21
    • PI

    • 9.69
    • Basic Residues

    • 9
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 6
    • Net Charge

    • +9
    • Boman Index

    • -92.38
    • Hydrophobicity

    • -0.522
    • Aliphatic Index

    • 45.12
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 46.63
    • Polar Residues

    • 21

DRAMP03370

DRAMP03370 chydropathy plot
    • PTM

    • Contains three disulfide bonds 9-37; 16-30; 20-38.
    • Predominantly expressed in skeletal muscle, also expressed in esophagus, tongue, and trachea. Also expressed in lung when induced by lipopolysaccharide. Expressed constitutively and induced by lipopolysaccharide (LPS).

  • ·Literature 1
    • Title

    • A novel mouse beta-defensin, mBD-6, predominantly expressed in skeletal muscle.
    • Reference

    • J Biol Chem. 2001 Aug 24;276(34):31510-31514.
    • Author

    • Yamaguchi Y, Fukuhara S, Nagase T, Tomita T, Hitomi S, Kimura S, Kurihara H, Ouchi Y.