General Information

    • DRAMP ID

    • DRAMP03371

    • Peptide Name

    • Beta-defensin 5 (BD-5, mBD-5; Defensin, beta 5; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb5

    • Sequence

    • KTINNPVSCCMIGGICRYLCKGNILQNGNCGVTSLNCCKRK

    • Sequence Length

    • 41

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03371 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03371.

Physicochemical Information

    • Formula

    • C181H312N58O54S8

    • Absent Amino Acids

    • ADEFHW

    • Common Amino Acids

    • C

    • Mass

    • 4421.3

    • PI

    • 9.21

    • Basic Residues

    • 6

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +6

    • Boman Index

    • -50.97

    • Hydrophobicity

    • 0.005

    • Aliphatic Index

    • 80.73

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 46.63

    • Polar Residues

    • 23

DRAMP03371

DRAMP03371 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 9-37; 16-30; 20-38.

Literature Information

  • ·Literature 1

    • Title

    • EST and genomic database mining yield novel human and mouse beta-defensins

    • Reference

    • Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases

    • Author

    • Adler D.A, Holloway J.L, Haldeman B.E, Rixon M, Jaspers S, Fox B, Gosink J, Sheppard P, Presnell S, Gao Z, Whitmore T, Stamm M, Laube D, Diamond G.