General Information

    • DRAMP ID

    • DRAMP03372

    • Peptide Name

    • Beta-defensin 7 (BD-7, mBD-7; Defensin, beta 7; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb7

    • Sequence

    • NSKRACYREGGECLQRCIGLFHKIGTCNFRFKCCKFQIPEKKTKIL

    • Sequence Length

    • 46

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03372 helical wheel diagram

    • PDB ID

    • 1E4T resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP03372.

Physicochemical Information

    • Formula

    • C237H385N71O61S6

    • Absent Amino Acids

    • DMVW

    • Common Amino Acids

    • K

    • Mass

    • 5397.46

    • PI

    • 9.59

    • Basic Residues

    • 12

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +9

    • Boman Index

    • -97.05

    • Hydrophobicity

    • -0.485

    • Aliphatic Index

    • 61.52

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 41.44

    • Polar Residues

    • 16

DRAMP03372

DRAMP03372 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 6-33; 13-27; 17-34.

Literature Information

  • ·Literature 1

    • Title

    • Cloning and characterization of mBD-7 and mBD-8, two novel mouse beta-defensins.

    • Reference

    • Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases.

    • Author

    • Conejo-Garcia JR, Nehls MC, Wattler S, Bals R, Heitland A, Kluever E, Liepke C, Adermann K, Forssmann WG.
  • ·Literature 2

    • Title

    • Structure determination of human and murine beta-defensins reveals structural conservation in the absence of significant sequence similarity.

    • Reference

    • Protein Sci. 2001 Dec;10(12):2470-2479.

    • Author

    • Bauer F, Schweimer K, Klüver E, Conejo-Garcia JR, Forssmann WG, Rösch P, Adermann K, Sticht H.