General Information

    • DRAMP ID

    • DRAMP03374

    • Peptide Name

    • Beta-defensin 9 (BD-9, mBD-9; Defensin, beta 9; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb9

    • Sequence

    • IIGVSEMERCHKKGGYCYFYCFSSHKKIGSCFPEWPRCCKNIK

    • Sequence Length

    • 43

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03374 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03374.

Physicochemical Information

    • Formula

    • C226H341N61O58S7

    • Absent Amino Acids

    • ADLQT

    • Common Amino Acids

    • CK

    • Mass

    • 5064.99

    • PI

    • 9.04

    • Basic Residues

    • 10

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +7

    • Boman Index

    • -64.77

    • Hydrophobicity

    • -0.421

    • Aliphatic Index

    • 43.02

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10345

    • Absorbance 280nm

    • 246.31

    • Polar Residues

    • 18

DRAMP03374

DRAMP03374 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 10-38; 17-31; 21-39.

    • Tissue specificity

    • Expressed in both adult and neonate brain, and very weakly in kidneys, epididymis, and testis.

Literature Information

  • ·Literature 1

    • Title

    • Signal sequence conservation and mature peptide divergence within subgroups of the murine beta-defensin gene family.

    • Reference

    • Mol Biol Evol. 2003 Mar;20(3):460-470.

    • Author

    • Morrison G.M, Semple C.A.M, Kilanowski F.M, Hill R.E, Dorin J.R.