General Information

    • DRAMP ID

    • DRAMP03376

    • Peptide Name

    • Beta-defensin 11 (BD-11, mBD-11; Defensin, beta 11; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb11

    • Sequence

    • DLKHLILKAQLARCYKFGGFCYNSMCPPHTKFIGNCHPDHLHCCINMKELEGST

    • Sequence Length

    • 54

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03376 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03376.

Physicochemical Information

    • Formula

    • C271H418N76O73S8

    • Absent Amino Acids

    • VW

    • Common Amino Acids

    • CLHK

    • Mass

    • 6165.25

    • PI

    • 8.31

    • Basic Residues

    • 11

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +7

    • Boman Index

    • -61.73

    • Hydrophobicity

    • -0.239

    • Aliphatic Index

    • 68.7

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 63.3

    • Polar Residues

    • 19

DRAMP03376

DRAMP03376 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 14-43; 21-36; 26-44.

    • Tissue specificity

    • Expressed in both adult and neonate brain, and very weakly in kidneys, epididymis, and testis.

Literature Information

  • ·Literature 1

    • Title

    • Signal sequence conservation and mature peptide divergence within subgroups of the murine beta-defensin gene family.

    • Reference

    • Mol Biol Evol. 2003 Mar;20(3):460-470.

    • Author

    • Morrison G.M, Semple C.A.M, Kilanowski F.M, Hill R.E, Dorin J.R.
  • ·Literature 2

    • Title

    • Lineage-specific biology revealed by a finished genome assembly of the mouse.

    • Reference

    • PLoS Biol. 2009 May 5;7(5):e1000112.

    • Author

    • Church D.M, Goodstadt L, Hillier L.W, Zody M.C, Goldstein S, et al, Ponting C.P.