General Information

    • DRAMP ID

    • DRAMP03377

    • Peptide Name

    • Beta-defensin 12 (BD-12, mBD-12; Defensin, beta 12; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb12

    • Sequence

    • GLEYSQSFPGGEIAVCETCRLGRGKCRRTCIESEKIAGWCKLNFFCCRERI

    • Sequence Length

    • 51

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03377 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03377.

Physicochemical Information

    • Formula

    • C248H397N75O72S7

    • Absent Amino Acids

    • DHM

    • Common Amino Acids

    • CEGR

    • Mass

    • 5805.76

    • PI

    • 8.58

    • Basic Residues

    • 9

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +3

    • Boman Index

    • -106.72

    • Hydrophobicity

    • -0.267

    • Aliphatic Index

    • 63.14

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 147.3

    • Polar Residues

    • 20

DRAMP03377

DRAMP03377 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 19-46; 26-40; 30-47.

    • Tissue specificity

    • Only expressed in epididymis (caput, corpus and cauda).

Literature Information

  • ·Literature 1

    • Title

    • Identification of multiple novel epididymis-specific beta-defensin isoforms in humans and mice.

    • Reference

    • J Immunol. 2002 Sep 1;169(5):2516-2523.

    • Author

    • Yamaguchi Y, Nagase T, Makita R, Fukuhara S, Tomita T, Tominaga T, Kurihara H, Ouchi Y.
  • ·Literature 2

    • Title

    • The transcriptional landscape of the mammalian genome.

    • Reference

    • Science. 2005 Sep 2;309(5740):1559-1563.

    • Author

    • Carninci P, Kasukawa T, Katayama S, et al.
  • ·Literature 3

    • Title

    • Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ.

    • Reference

    • J Biol Chem. 2004 Mar 26;279(13):12421-12426.

    • Author

    • Zaballos A, Villares R, Albar JP, Martínez-A C, Márquez G.