General Information

    • DRAMP ID

    • DRAMP03379

    • Peptide Name

    • Beta-defensin 14 (BD-14, mBD-14; Defensin, beta 14; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Not found

    • Sequence

    • FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK

    • Sequence Length

    • 45

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03379 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03379.

Physicochemical Information

    • Formula

    • C221H380N76O56S6

    • Absent Amino Acids

    • DHMWY

    • Common Amino Acids

    • KR

    • Mass

    • 5190.28

    • PI

    • 10.41

    • Basic Residues

    • 14

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +12

    • Boman Index

    • -128.41

    • Hydrophobicity

    • -0.636

    • Aliphatic Index

    • 60.67

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 8.52

    • Polar Residues

    • 16

DRAMP03379

DRAMP03379 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 11-40; 18-33; 23-41.

Literature Information

  • ·Literature 1

    • Title

    • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).

    • Reference

    • Genome Res. 2004 Oct;14(10B):2121-2127.

    • Author

    • Gerhard DS, Wagner L, et al.
  • ·Literature 2

    • Title

    • Identification and Biological Characterization of Mouse beta-defensin 14, the orthologue of human beta-defensin 3.

    • Reference

    • J Biol Chem. 2008 Feb 29;283(9):5414-5419.

    • Author

    • Röhrl J, Yang D, Oppenheim JJ, Hehlgans T.