General Information

    • DRAMP ID

    • DRAMP03380

    • Peptide Name

    • Beta-defensin 15 (BD-15, mBD-15; Defensin, beta 15; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb15

    • Sequence

    • FFDEKCSRVNGRCTASCLKNEELVALCQKNLKCCVTVQPCGKSKSNQSDEGSGHMGTWG

    • Sequence Length

    • 59

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03380 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03380.

Physicochemical Information

    • Formula

    • C265H429N81O88S8

    • Absent Amino Acids

    • IY

    • Common Amino Acids

    • CGKS

    • Mass

    • 6414.29

    • PI

    • 8.25

    • Basic Residues

    • 9

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +3

    • Boman Index

    • -119.07

    • Hydrophobicity

    • -0.548

    • Aliphatic Index

    • 49.49

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 101.29

    • Polar Residues

    • 26

DRAMP03380

DRAMP03380 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 6-33; 13-27; 17-34.

    • Tissue specificity

    • Expressed in testis and to a lesser extent in epididymis (caput, corpus and cauda). Also weakly expressed in kidneys and colon.

Literature Information

  • ·Literature 1

    • Title

    • Signal sequence conservation and mature peptide divergence within subgroups of the murine beta-defensin gene family.

    • Reference

    • Mol Biol Evol. 2003 Mar;20(3):460-470.

    • Author

    • Morrison G.M, Semple C.A.M, Kilanowski F.M, Hill R.E, Dorin J.R.
  • ·Literature 2

    • Title

    • Lineage-specific biology revealed by a finished genome assembly of the mouse.

    • Reference

    • PLoS Biol. 2009 May 5;7(5):e1000112.

    • Author

    • Church D.M, Goodstadt L, Hillier L.W, Zody M.C, Goldstein S. et al, Ponting C.P.
  • ·Literature 3

    • Title

    • Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ.

    • Reference

    • J Biol Chem. 2004 Mar 26;279(13):12421-6.

    • Author

    • Zaballos A, Villares R, Albar JP, Martínez-A C, Márquez G.