General Information

    • DRAMP ID

    • DRAMP03382

    • Peptide Name

    • Beta-defensin 18 (BD-18, mBD-18; Defensin, beta 18; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb18

    • Sequence

    • APQMKTREVAERTHKCSLVRGTCKSECNSWEYKYNYCHTEPCCVVREYKRMEKLLSTPKYTT

    • Sequence Length

    • 62

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03382 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03382.

Physicochemical Information

    • Formula

    • C317H504N92O96S8

    • Absent Amino Acids

    • DFI

    • Common Amino Acids

    • EKTC

    • Mass

    • 7396.53

    • PI

    • 8.99

    • Basic Residues

    • 14

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +7

    • Boman Index

    • -171.36

    • Hydrophobicity

    • -0.989

    • Aliphatic Index

    • 40.81

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 13325

    • Absorbance 280nm

    • 218.44

    • Polar Residues

    • 25

DRAMP03382

DRAMP03382 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil A.A, Cai Y, Sang Y, Blecha F, Zhang G.