General Information

    • DRAMP ID

    • DRAMP03383

    • Peptide Name

    • Beta-defensin 19 (BD-19, mBD-19; Defensin, beta 19; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb19

    • Sequence

    • GKNPILQCMGNRGFCRSSCKKSEQAYFYCRTFQMCCLQSYVRISLTGVDDNTNWSYEKHWPRIP

    • Sequence Length

    • 64

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03383 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03383.

Physicochemical Information

    • Formula

    • C329H501N95O94S8

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • CSR

    • Mass

    • 7547.66

    • PI

    • 9.06

    • Basic Residues

    • 10

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +6

    • Boman Index

    • -140.76

    • Hydrophobicity

    • -0.645

    • Aliphatic Index

    • 47.19

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 17335

    • Absorbance 280nm

    • 275.16

    • Polar Residues

    • 27

DRAMP03383

DRAMP03383 chydropathy plot

Comments Information

    • Specifically expressed in male gonads (Sertoli cells). Not detected at 11.5 dpc. Specific signals are observed within seminiferous cords in male gonads at 12.5, 13.5, 14.5, and 16.5 dpc and in newborn testes. In 16.5 and newborn testes, its expression is also found in epididymis. No specific signal is found in female gonads.

Literature Information

  • ·Literature 1

    • Title

    • Testis-specific expression of a novel mouse defensin-like gene, Tdl.

    • Reference

    • Mech Dev. 2002 Aug;116(1-2):217-221.

    • Author

    • Yamamoto M, Matsui Y.