• DRAMP ID

    • DRAMP03385
    • Peptide Name

    • Beta-defensin 25 (BD-25, mBD-25; Defensin, beta 25; Rodents, mammals, animals)
    • Source

    • Mus musculus (Mouse)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Defb25
    • Sequence

    • EFKRCWNGQGACRTFCTRQETFMHLCPDASLCCLSYSFKPSRPSRVGDV
    • Sequence Length

    • 49
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03385 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03385.
    • Formula

    • C241H370N72O70S7
    • Absent Amino Acids

    • I
    • Common Amino Acids

    • C
    • Mass

    • 5620.45
    • PI

    • 8.68
    • Basic Residues

    • 8
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +4
    • Boman Index

    • -110.43
    • Hydrophobicity

    • -0.425
    • Aliphatic Index

    • 39.8
    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7365
    • Absorbance 280nm

    • 153.44
    • Polar Residues

    • 19

DRAMP03385

DRAMP03385 chydropathy plot
    • PTM

    • Contains three disulfide bonds 5-32; 12-26; 16-33.
  • ·Literature 1
    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.
    • Author

    • Patil A.A, Cai Y, Sang Y, Blecha F, Zhang G.