General Information

    • DRAMP ID

    • DRAMP03386

    • Peptide Name

    • Beta-defensin 29 (BD-29, mBD-29; Defensin, beta 29; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb29

    • Sequence

    • GLFGFRSSKRQEPWIACELYQGLCRNACQKYEIQYLSCPKTRKCCLKYPRKITSF

    • Sequence Length

    • 55

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03386 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03386.

Physicochemical Information

    • Formula

    • C292H458N82O77S6

    • Absent Amino Acids

    • DHMV

    • Common Amino Acids

    • CKLR

    • Mass

    • 6541.71

    • PI

    • 9.5

    • Basic Residues

    • 11

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +8

    • Boman Index

    • -111.68

    • Hydrophobicity

    • -0.566

    • Aliphatic Index

    • 60.36

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11835

    • Absorbance 280nm

    • 219.17

    • Polar Residues

    • 20

DRAMP03386

DRAMP03386 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 17-44; 24-38; 28-45.

Literature Information

  • ·Literature 1

    • Title

    • The transcriptional landscape of the mammalian genome.

    • Reference

    • Science. 2005 Sep 2;309(5740):1559-1563.

    • Author

    • Carninci P, Kasukawa T, Katayama S, Gough J, Frith M.C, et al, Hayashizaki Y.