• DRAMP ID

    • DRAMP03387
    • Peptide Name

    • Beta-defensin 30 (BD-30, mBD-30; Defensin, beta 30; Rodents, mammals, animals)
    • Source

    • Mus musculus (Mouse)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Defb30
    • Sequence

    • GVNMYIKRIYDTCWKLKGICRNTCQKEEIYHIFCGIQSLCCLEKKEMPVLFVK
    • Sequence Length

    • 53
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03387 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03387.
    • Formula

    • C283H453N73O74S8
    • Absent Amino Acids

    • A
    • Common Amino Acids

    • KCI
    • Mass

    • 6318.63
    • PI

    • 8.83
    • Basic Residues

    • 10
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +5
    • Boman Index

    • -57.82
    • Hydrophobicity

    • -0.03
    • Aliphatic Index

    • 90
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 10345
    • Absorbance 280nm

    • 198.94
    • Polar Residues

    • 17

DRAMP03387

DRAMP03387 chydropathy plot
    • PTM

    • Contains three disulfide bonds 13-40; 20-34; 24-41.
  • ·Literature 1
    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.
    • Author

    • Patil A.A, Cai Y, Sang Y, Blecha F, Zhang G.
  • ·Literature 2
    • Title

    • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
    • Reference

    • Genome Res. 2004 Oct;14(10B):2121-2127.
    • Author

    • Gerhard DS, Wagner L, et al.