General Information

    • DRAMP ID

    • DRAMP03393

    • Peptide Name

    • Beta-defensin 38 (BD-38, mBD-38; Defensin, beta 38; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb38

    • Sequence

    • IGPDTKKCVQRKNACHYFECPWLYYSVGTCYKGKGKCCQKRY

    • Sequence Length

    • 42

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli, Pseudomonas aeruginosa, Enterococcus faecium.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03393 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03393.

Physicochemical Information

    • Formula

    • C220H335N61O58S6

    • Absent Amino Acids

    • M

    • Common Amino Acids

    • K

    • Mass

    • 4954.81

    • PI

    • 9.3

    • Basic Residues

    • 10

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +8

    • Boman Index

    • -79.36

    • Hydrophobicity

    • -0.836

    • Aliphatic Index

    • 34.76

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 13325

    • Absorbance 280nm

    • 325

    • Polar Residues

    • 19

DRAMP03393

DRAMP03393 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 8-37; 15-30; 20-38.

Literature Information

  • ·Literature 1

    • Title

    • Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ.

    • Reference

    • J Biol Chem. 2004 Mar 26;279(13):12421-12426.

    • Author

    • Zaballos A, Villares R, Albar JP, Martínez-A C, Márquez G.