General Information

    • DRAMP ID

    • DRAMP03394

    • Peptide Name

    • Beta-defensin 39 (BD-39, mBD-39; Defensin, beta 39; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb39

    • Sequence

    • DDSIQCFQKNNTCHTNQCPYFQDEIGTCYDKRGKCCQKRLLHIRVPRKKKV

    • Sequence Length

    • 51

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03394 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03394.

Physicochemical Information

    • Formula

    • C259H418N82O76S6

    • Absent Amino Acids

    • AMW

    • Common Amino Acids

    • KC

    • Mass

    • 6089.03

    • PI

    • 9.22

    • Basic Residues

    • 13

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +8

    • Boman Index

    • -160.35

    • Hydrophobicity

    • -1.11

    • Aliphatic Index

    • 49.61

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 67.1

    • Polar Residues

    • 17

DRAMP03394

DRAMP03394 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 6-35; 13-28; 18-36.

Literature Information

  • ·Literature 1

    • Title

    • Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ.

    • Reference

    • J Biol Chem. 2004 Mar 26;279(13):12421-12426.

    • Author

    • Zaballos A, Villares R, Albar JP, Martínez-A C, Márquez G.