• DRAMP ID

    • DRAMP03394
    • Peptide Name

    • Beta-defensin 39 (BD-39, mBD-39; Defensin, beta 39; Rodents, mammals, animals)
    • Source

    • Mus musculus (Mouse)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Defb39
    • Sequence

    • DDSIQCFQKNNTCHTNQCPYFQDEIGTCYDKRGKCCQKRLLHIRVPRKKKV
    • Sequence Length

    • 51
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03394 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03394.
    • Formula

    • C259H418N82O76S6
    • Absent Amino Acids

    • AMW
    • Common Amino Acids

    • KC
    • Mass

    • 6089.03
    • PI

    • 9.22
    • Basic Residues

    • 13
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +8
    • Boman Index

    • -160.35
    • Hydrophobicity

    • -1.11
    • Aliphatic Index

    • 49.61
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 67.1
    • Polar Residues

    • 17

DRAMP03394

DRAMP03394 chydropathy plot
    • PTM

    • Contains three disulfide bonds 6-35; 13-28; 18-36.
  • ·Literature 1
    • Title

    • Identification on mouse chromosome 8 of new beta-defensin genes with regionally specific expression in the male reproductive organ.
    • Reference

    • J Biol Chem. 2004 Mar 26;279(13):12421-12426.
    • Author

    • Zaballos A, Villares R, Albar JP, Martínez-A C, Márquez G.