General Information

    • DRAMP ID

    • DRAMP03396

    • Peptide Name

    • Beta-defensin 41 (BD-41, mBD-41; Defensin, beta 41; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb41

    • Sequence

    • RSHIDIKNGIERCEKVRGMCKTVCDIDEYDYGYCIRWRNQCCI

    • Sequence Length

    • 43

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03396 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03396.

Physicochemical Information

    • Formula

    • C218H347N67O66S7

    • Absent Amino Acids

    • AFLP

    • Common Amino Acids

    • CI

    • Mass

    • 5186.98

    • PI

    • 7.77

    • Basic Residues

    • 9

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +2

    • Boman Index

    • -123.65

    • Hydrophobicity

    • -0.642

    • Aliphatic Index

    • 67.91

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 10345

    • Absorbance 280nm

    • 246.31

    • Polar Residues

    • 16

DRAMP03396

DRAMP03396 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 13-41; 20-34; 24-42.

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil A.A, Cai Y, Sang Y, Blecha F, Zhang G.
  • ·Literature 2

    • Title

    • Discovery and characterization of new epididymis-specific beta-defensins in mice.

    • Reference

    • Biochim. Biophys. 2005 Acta 1730:22-30.

    • Author

    • Jalkanen J, Huhtaniemi I, Poutanen M.