General Information

    • DRAMP ID

    • DRAMP03397

    • Peptide Name

    • Beta-defensin 43 (BD-43, mBD-43; Defensin, beta 43; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb43

    • Sequence

    • FLENQDCSKHRHCRMKCKANEYAVRYCEDWTICCRVKKKESKKKKMW

    • Sequence Length

    • 47

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03397 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03397.

Physicochemical Information

    • Formula

    • C252H404N78O68S8

    • Absent Amino Acids

    • GP

    • Common Amino Acids

    • K

    • Mass

    • 5870.94

    • PI

    • 9.44

    • Basic Residues

    • 16

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +10

    • Boman Index

    • -156.09

    • Hydrophobicity

    • -1.27

    • Aliphatic Index

    • 33.19

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 14355

    • Absorbance 280nm

    • 312.07

    • Polar Residues

    • 13

DRAMP03397

DRAMP03397 chydropathy plot

Comments Information

    • PTM

    • Contains two disulfide bonds

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil A.A, Cai Y, Sang Y, Blecha F, Zhang G.
  • ·Literature 2

    • Title

    • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).

    • Reference

    • Genome Res. 2004 Oct;14(10B):2121-2127.

    • Author

    • Gerhard DS, Wagner L, et al.