General Information

    • DRAMP ID

    • DRAMP03398

    • Peptide Name

    • Beta-defensin 50 (BD-50, mBD-50; Defensin, beta 50; Prostate beta-defensin 1; Rodents, mammals, a

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb50

    • Sequence

    • HPGTFHVRIKCMPKMTAVFGDNCSFYSSMGDLCNNTKSVCCMVPVRMDNI

    • Sequence Length

    • 50

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03398 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03398.

Physicochemical Information

    • Formula

    • C237H375N67O69S10

    • Absent Amino Acids

    • EQW

    • Common Amino Acids

    • CMVNS

    • Mass

    • 5587.59

    • PI

    • 8.41

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +4

    • Boman Index

    • -63.3

    • Hydrophobicity

    • 0.036

    • Aliphatic Index

    • 54.4

    • Half Life

      • Mammalian:3.5 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1740

    • Absorbance 280nm

    • 35.51

    • Polar Residues

    • 20

DRAMP03398

DRAMP03398 chydropathy plot

Comments Information

    • PTM

    • Contains two disulfide bonds 11-40; 23-41.

Literature Information

  • ·Literature 1

    • Title

    • Expressed sequence tag profiling identifies developmental and anatomic partitioning of gene expression in the mouse prostate.

    • Reference

    • Genome Biol. 2003;4(12):R79.

    • Author

    • Abbott D.E, Pritchard C, Clegg N.J, Ferguson C, Dumpit R, Sikes R.A, Nelson P.S.