General Information

    • DRAMP ID

    • DRAMP03399

    • Peptide Name

    • Sperm-associated antigen 11 (Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Spag11

    • Sequence

    • PGDIPPGIRNTVCLMQQGHCRLFMCRSGERKGDICSDPWNRCCVPYSVKDRR

    • Sequence Length

    • 52

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03399 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03399.

Physicochemical Information

    • Formula

    • C249H402N82O72S8

    • Absent Amino Acids

    • A

    • Common Amino Acids

    • RC

    • Mass

    • 5952.92

    • PI

    • 8.98

    • Basic Residues

    • 10

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +5

    • Boman Index

    • -140.05

    • Hydrophobicity

    • -0.654

    • Aliphatic Index

    • 54.23

    • Half Life

      • Mammalian:>20 hour
      • Yeast:>20 hour
      • E.coli:?

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 144.41

    • Polar Residues

    • 18

DRAMP03399

DRAMP03399 chydropathy plot

Comments Information

    • Is also responsible for sperm maturation, storage, and protection.

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil A.A, Cai Y, Sang Y, Blecha F, Zhang G.
  • ·Literature 2

    • Title

    • Identification of multiple novel epididymis-specific beta-defensin isoforms in humans and mice.

    • Reference

    • J Immunol. 2002 Sep 1;169(5):2516-2523.

    • Author

    • Yamaguchi Y, Nagase T, Makita R, Fukuhara S, Tomita T, Tominaga T, Kurihara H, Ouchi Y.