General Information

    • DRAMP ID

    • DRAMP03401

    • Peptide Name

    • WAP four-disulfide core domain protein 15A (Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Not found

    • Gene

    • Wfdc15a

    • Sequence

    • QPRATRKGVTPKQGYCPEFLLDCPFVLLPVCSRDKGCKGTKKCCFYYCQMRCVEPWTTLT

    • Sequence Length

    • 60

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03401 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03401.

Physicochemical Information

    • Formula

    • C305H480N82O82S9

    • Absent Amino Acids

    • HIN

    • Common Amino Acids

    • C

    • Mass

    • 6896.21

    • PI

    • 9.03

    • Basic Residues

    • 10

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +6

    • Boman Index

    • -89.71

    • Hydrophobicity

    • -0.317

    • Aliphatic Index

    • 53.5

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10470

    • Absorbance 280nm

    • 177.46

    • Polar Residues

    • 22

DRAMP03401

DRAMP03401 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • The transcriptional landscape of the mammalian genome.

    • Reference

    • Science. 2005 Sep 2;309(5740):1559-1563.

    • Author

    • Carninci P, Kasukawa T, Katayama S, et al.