General Information

    • DRAMP ID

    • DRAMP03402

    • Peptide Name

    • WAP four-disulfide core domain protein 15B (Elafin-like protein I; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Not found

    • Gene

    • Wfdc15b

    • Sequence

    • RPEIKKKNVFSKPGYCPEYRVPCPFVLIPKCRRDKGCKDALKCCFFYCQMRCVDPWESPE

    • Sequence Length

    • 60

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli (IC90=10 µM);
      • Gram-positive bacterium: Staphylococcus aureus (IC90=10 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03402 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03402.

Physicochemical Information

    • Formula

    • C319H494N86O82S9

    • Absent Amino Acids

    • HT

    • Common Amino Acids

    • CKP

    • Mass

    • 7134.5

    • PI

    • 9

    • Basic Residues

    • 13

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +6

    • Boman Index

    • -125.43

    • Hydrophobicity

    • -0.615

    • Aliphatic Index

    • 47

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 10470

    • Absorbance 280nm

    • 177.46

    • Polar Residues

    • 16

DRAMP03402

DRAMP03402 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Mouse SWAM1 and SWAM2 are antibacterial proteins composed of a single whey acidic protein motif.

    • Reference

    • J Immunol. 2003 Feb 15;170(4):1973-1979.

    • Author

    • Hagiwara K, Kikuchi T, Endo Y, Huqun, Usui K, Takahashi M, Shibata N, Kusakabe T, Xin H, Hoshi S, Miki M, Inooka N, Tokue Y, Nukiwa T.