General Information

    • DRAMP ID

    • DRAMP03403

    • Peptide Name

    • SP-BN (N-terminal region of Surfactant Protein B; SAPLIP; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • AGANDLCQECEDIVHLLTKMTKEDAFQDTIRKFLEQECDILPLKLLVPRCRQVLDVYLPLVIDYFQGQIKPKAICSHVGLC

    • Sequence Length

    • 81

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03403 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03403.

Physicochemical Information

    • Formula

    • C412H667N107O119S7

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • L

    • Mass

    • 9247.89

    • PI

    • 5.18

    • Basic Residues

    • 11

    • Acidic Residues

    • 12

    • Hydrophobic Residues

    • 31

    • Net Charge

    • -1

    • Boman Index

    • -91.91

    • Hydrophobicity

    • 0.091

    • Aliphatic Index

    • 113.09

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 41.94

    • Polar Residues

    • 16

DRAMP03403

DRAMP03403 chydropathy plot

Comments Information

    • Transgenic mice overexpressing SP-BN has significantly decreased bacterial burden and increased survival following intranasal inoculation with bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Surfactant protein B propeptide contains a saposin-like protein domain with antimicrobial activity at low pH.

    • Reference

    • J Immunol. 2010 Jan 15;184(2):975-983.

    • Author

    • Yang L, Johansson J, Ridsdale R, Willander H, Fitzen M, Akinbi HT, Weaver TE.