• • DRAMP ID

  • DRAMP03405

• • Peptide Name

  • mCRAMP-1 (mouse cathelin-related antimicrobial peptide 1; cathelicidin; Rodents, mammals, animals

• • Source

  • Mus musculus (Mouse)

• • Family

  • Not found

• • Gene

  • Camp

• • Sequence

  • GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE

• • Sequence Length

  • 33

• • UniProt Entry

  • P51437,Q0VB78

• • Protein Existence

  • Transcript level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC=1 µM), Escherichia coli ML35 (MIC=2 µM), Escherichia coli D21 (MIC=8 µM), Pseudomonas aeruginosa ATCC 27853 (MIC=4 µM), Serratia marcescens ATCC 8100 (MIC=4 µM);
    • Gram-positive bacteria: Staphylococcus aureus ATCC 25923 (MIC=32 µM), Staphylococcus aureus Cowan I (MIC=32 µM), Staphylococcus aureus (MRSA) (MIC>64 µM), Staphylococcus aureus (MRSA) (MIC=64 µM), Staphylococcus epidermidis ATCC 12228 (MIC=16 µM), Streptococcus faecalis ATCC 29212 (MIC=16 µM), Bacillus megaterium Bm11 (MIC=4 µM).
    • Fungi: Candida albicans (MIC>64 µM), Cryptococcus neoformans (MIC=16 µM).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Free

• • Stereochemistry

  • L

• • Structure

  • Alpha helix (CD)

• • Structure Description

  • The spectra of 10-25 µm synthetic CRAMP-1 in buffer suggest that the peptide is in a random coil configuration and that it will assume a helical structure in the presence of 15–45% (v/v) trifluoroethanol.

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• Please click DRAMP03405_predicted_structure.pdb to download.

DRAMP03405

• • Function

  • Acts as a potent antimicrobial peptide.

• • Tissue specificity

  • Expressed in testis, spleen, stomach, and intestine. Very low expression found in heart, lung and skeletal muscle. No expression in brain, kidney or liver.

• ·Literature 1

• • Title

  • Identification of CRAMP, a cathelin-related antimicrobial peptide expressed in the embryonic and adult mouse.

• • Pubmed ID

  • 9148921

• • Reference

  • J Biol Chem. 1997 May 16;272(20):13088-13093.

• • Author

  • Gallo RL, Kim KJ, Bernfield M, Kozak CA, Zanetti M, Merluzzi L, Gennaro R.

• ·Literature 2

• • Title

  • A novel murine cathelin-like protein expressed in bone marrow.

• • Pubmed ID

  • 8706928

• • Reference

  • FEBS Lett. 1996 Aug 5;391(1-2):5-8.

• • Author

  • Popsueva AE, Zinovjeva MV, Visser JW, Zijlmans JM, Fibbe WE, Belyavsky AV.