• • DRAMP ID

  • DRAMP03409

• • Peptide Name

  • Neutrophil defensin 2 (HANP-2; alpha-defensin; Rodents, mammals, animals)

• • Source

  • Mesocricetus auratus (Golden hamster)

• • Family

  • Belongs to the alpha-defensin family

• • Gene

  • Not found

• • Sequence

  • CFCKRPVCDSGETQIGYCRLGNTFYRLCCRQ

• • Sequence Length

  • 31

• • UniProt Entry

  • P81466

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Gram-positive bacteria: Staphylococcus aureus, Streptococcus pyogenes, Enterococcus faecalis;
    • Gram-negative bacteria: Escherichia coli, Salmonella serotype krefeld, Klebsiella oxytoca, Pseudomonas aeruginosa.
    • Fungi: Candida albicans, Cryptococcus neoformans.

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Cyclization(Cys1 and Cys29).

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Disulfide bonds between Cys1 and Cys29,Cys3 and Cys18,Cys8 and Cys28.

• • Stereochemistry

  • L

• • Structure

  • Bridge

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP03409.

DRAMP03409

• • Function

  • Bactericidal activity, greater against Gram-positive bacteria. Low anti-fungi activity

• ·Literature 1

• • Title

  • Isolation, antimicrobial activities, and primary structures of hamster neutrophil defensins.

• • Pubmed ID

  • 8890190

• • Reference

  • Infect Immun. 1996 Nov;64(11):4444-4449.

• • Author

  • Mak P, Wójcik K, Thogersen IB, Dubin A.