General Information

    • DRAMP ID

    • DRAMP03411

    • Peptide Name

    • Neutrophil defensin 4 (HANP-4; alpha-defensin; Rodents, mammals, animals)

    • Source

    • Mesocricetus auratus (Golden hamster)

    • Family

    • Belongs to the alpha-defensin family

    • Gene

    • Not found

    • Sequence

    • VTCFCKRPVCDSGETQIGYCRLGNTFYRLCCRQ

    • Sequence Length

    • 33

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus, Streptococcus pyogenes, Enterococcus faecalis;
      • Gram-negative bacteria: Escherichia coli, Salmonella serotype krefeld, Klebsiella oxytoca, Pseudomonas aeruginosa.
      • Fungi: Candida albicans, Cryptococcus neoformans.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys3 and Cys31,Cys5 and Cys20,Cys10 and Cys30.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03411 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03411.

Physicochemical Information

    • Formula

    • C161H255N49O47S6

    • Absent Amino Acids

    • AHMW

    • Common Amino Acids

    • C

    • Mass

    • 3821.46

    • PI

    • 8.67

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +3

    • Boman Index

    • -70.57

    • Hydrophobicity

    • -0.2

    • Aliphatic Index

    • 53.03

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 104.84

    • Polar Residues

    • 16

DRAMP03411

DRAMP03411 chydropathy plot

Comments Information

    • Function

    • Bactericidal activity, greater against Gram-positive bacteria. Low anti-fungi activity.

Literature Information

  • ·Literature 1

    • Title

    • Isolation, antimicrobial activities, and primary structures of hamster neutrophil defensins.

    • Reference

    • Infect Immun. 1996 Nov;64(11):4444-4449.

    • Author

    • Mak P, Wójcik K, Thogersen IB, Dubin A.