General Information

    • DRAMP ID

    • DRAMP03413

    • Peptide Name

    • Defensin 7

    • Source

    • Rattus norvegicus (Rat)

    • Family

    • Not found

    • Gene

    • Defa24

    • Sequence

    • MKTLVLLSALVLLALQVQAEPTPKTDEGTKTDEQPGKEDQVVSVSIEGQGDPAFQDGVLRDLKCFCRAKSCNWGEGIMGICNKRYGMLILCCR

    • Sequence Length

    • 93

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03413 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03413.

Physicochemical Information

    • Formula

    • C439H723N121O136S9

    • Absent Amino Acids

    • H

    • Common Amino Acids

    • L

    • Mass

    • 10160.84

    • PI

    • 5.33

    • Basic Residues

    • 11

    • Acidic Residues

    • 12

    • Hydrophobic Residues

    • 30

    • Net Charge

    • -1

    • Boman Index

    • -122.21

    • Hydrophobicity

    • -0.104

    • Aliphatic Index

    • 90.11

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 80.05

    • Polar Residues

    • 27

DRAMP03413

DRAMP03413 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Identification and expression of alpha-defensin genes in the rat small intestine.

    • Reference

    • Infect. Immun. 2004,0:0-0.

    • Author

    • Viera A., Kurland A.R., Condon M.R., Diamond G.
  • ·Literature 2

    • Title

    • Reference

    • Author