General Information

    • DRAMP ID

    • DRAMP03416

    • Peptide Name

    • Defensin alpha 10 (Defensin)

    • Source

    • Rattus norvegicus (Rat)

    • Family

    • Not found

    • Gene

    • Defa10

    • Sequence

    • MRTLTLLTALLLLALHTQAESPQGSPKEAPDQEQLDMEDQDISVFFGGDKGTALQDAAGSTCSCRIGTCVSGEWLSWVCRINGRIYRLCCR

    • Sequence Length

    • 91

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03416 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03416.

Physicochemical Information

    • Formula

    • C426H686N122O136S8

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • L

    • Mass

    • 9949.35

    • PI

    • 4.9

    • Basic Residues

    • 9

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 30

    • Net Charge

    • -2

    • Boman Index

    • -139.43

    • Hydrophobicity

    • -0.103

    • Aliphatic Index

    • 85.82

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12865

    • Absorbance 280nm

    • 142.94

    • Polar Residues

    • 30

DRAMP03416

DRAMP03416 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Rapid duplication and diversification of mammalian alpha-defensins as evidenced by comparative analysis of rodent and human defensin genes.

    • Reference

    • Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases

    • Author

    • Patil A, Zhang G.
  • ·Literature 2

    • Title

    • Reference

    • Author