General Information

    • DRAMP ID

    • DRAMP03424

    • Peptide Name

    • Beta-defensin 1 (BD-1, RBD-1; Defensin, beta 1; Rodents, mammals, animals)

    • Source

    • Rattus norvegicus (Rat)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb1

    • Sequence

    • DQYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCRS

    • Sequence Length

    • 37

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03424 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03424.

Physicochemical Information

    • Formula

    • C168H272N56O54S6

    • Absent Amino Acids

    • AEIMVW

    • Common Amino Acids

    • C

    • Mass

    • 4132.71

    • PI

    • 8.92

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 4

    • Net Charge

    • +5

    • Boman Index

    • -104.05

    • Hydrophobicity

    • -0.962

    • Aliphatic Index

    • 31.62

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 51.81

    • Polar Residues

    • 18

DRAMP03424

DRAMP03424 chydropathy plot

Comments Information

    • Function Has antibacterial activity (By similarity).

    • PTM

    • Contains three disulfide bonds 5-34; 12-27; 17-35.

Literature Information

  • ·Literature 1

    • Title

    • Rat beta defensin-1 peptide: candidate marker for diabetic nephropathy.

    • Reference

    • Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases.

    • Author

    • Page R.A, Malik A.N.
  • ·Literature 2

    • Title

    • Molecular cloning and characterization of rat genes encoding homologues of human beta-defensins.

    • Reference

    • Infect Immun. 1999 Sep;67(9):4827-4833.

    • Author

    • Jia HP, Mills JN, Barahmand-Pour F, Nishimura D, Mallampali RK, Wang G, Wiles K, Tack BF, Bevins CL, McCray PB Jr.