General Information

    • DRAMP ID

    • DRAMP03427

    • Peptide Name

    • Beta-defensin 5 (BD-5, RBD-5; Defensin, beta 5; Rodents, mammals, animals)

    • Source

    • Rattus norvegicus (Rat)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb5

    • Sequence

    • QSINNPVSCVTHGGICWGRCPGSFRQIGTCGLGKVRCCKKK

    • Sequence Length

    • 41

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03427 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03427.

Physicochemical Information

    • Formula

    • C184H305N61O51S6

    • Absent Amino Acids

    • ADEMY

    • Common Amino Acids

    • G

    • Mass

    • 4380.18

    • PI

    • 9.62

    • Basic Residues

    • 8

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +8

    • Boman Index

    • -59.95

    • Hydrophobicity

    • -0.227

    • Aliphatic Index

    • 59.27

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 146.88

    • Polar Residues

    • 20

DRAMP03427

DRAMP03427 chydropathy plot

Comments Information

    • Function Has antibacterial activity (By similarity).

    • PTM

    • Contains three disulfide bonds 9-37; 16-30; 20-38.

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.