General Information

    • DRAMP ID

    • DRAMP03449

    • Peptide Name

    • Beta-defensin 39 (BD-39, RBD-39; Defensin, beta 39; Rodents, mammals, animals)

    • Source

    • Rattus norvegicus (Rat)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb39

    • Sequence

    • IDSVKCFQKNNTCHTIRCPYFQDEVGTCYEGRGKCCQKRLLSIRVPKKKV

    • Sequence Length

    • 50

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03449 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03449.

Physicochemical Information

    • Formula

    • C251H412N76O71S6

    • Absent Amino Acids

    • AMW

    • Common Amino Acids

    • KC

    • Mass

    • 5822.86

    • PI

    • 9.38

    • Basic Residues

    • 12

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +8

    • Boman Index

    • -121.72

    • Hydrophobicity

    • -0.644

    • Aliphatic Index

    • 62.2

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 68.47

    • Polar Residues

    • 18

DRAMP03449

DRAMP03449 chydropathy plot

Comments Information

    • Function Has antibacterial activity (By similarity).

    • PTM

    • Contains three disulfide bonds 6-35; 13-28; 18-36.

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.