General Information

    • DRAMP ID

    • DRAMP03457

    • Peptide Name

    • Beta-defensin 51 (Protein Defb51; rodents, mammals, animals)

    • Source

    • Rattus norvegicus (Rat)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb51

    • Sequence

    • MRIHAFLALLAIFQVLHAITSALNFQRPCYLRGGICLKQGTPNCEPFRGPCRAFTVCCKIRS

    • Sequence Length

    • 62

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03457 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03457.

Physicochemical Information

    • Formula

    • C311H499N91O76S7

    • Absent Amino Acids

    • DW

    • Common Amino Acids

    • LACR

    • Mass

    • 6953.37

    • PI

    • 9.69

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 25

    • Net Charge

    • +9

    • Boman Index

    • -54.63

    • Hydrophobicity

    • 0.387

    • Aliphatic Index

    • 94.52

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 30.57

    • Polar Residues

    • 18

DRAMP03457

DRAMP03457 chydropathy plot

Comments Information

    • Function Has antibacterial activity (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.