General Information

    • DRAMP ID

    • DRAMP03459

    • Peptide Name

    • DEFB24 (defensin; Rodents, mammals, animals)

    • Source

    • Rattus norvegicus (Rat)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GKNPTLQCMGNRGFCRPSCKKGEQAYFYCRTYQICCLQSHVRISLTGVEDNTNWSYEKHWPRIP

    • Sequence Length

    • 64

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03459 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03459.

Physicochemical Information

    • Formula

    • C327H499N97O93S7

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • CGR

    • Mass

    • 7501.57

    • PI

    • 9.06

    • Basic Residues

    • 11

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +7

    • Boman Index

    • -143.67

    • Hydrophobicity

    • -0.786

    • Aliphatic Index

    • 47.19

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 17335

    • Absorbance 280nm

    • 275.16

    • Polar Residues

    • 27

DRAMP03459

DRAMP03459 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Identification, cloning and functional characterization of novel beta-defensins in the rat (Rattus norvegicus).

    • Reference

    • Reprod Biol Endocrinol. 2006 Feb 4;4:7.

    • Author

    • Yenugu S, Chintalgattu V, Wingard CJ, Radhakrishnan Y, French FS, Hall SH.