General Information

    • DRAMP ID

    • DRAMP03460

    • Peptide Name

    • WAP four-disulfide core domain protein 12 (mammals, rodents, animals)

    • Source

    • Rattus norvegicus (Rat)

    • Family

    • Not found

    • Gene

    • Wfdc12

    • Sequence

    • GGVKGAEKGVCPPDNVRCIRGEDPQCHNDNDCKDQKICCYWHCGFKCVQPVKDSWEQ

    • Sequence Length

    • 57

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03460 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03460.

Physicochemical Information

    • Formula

    • C270H414N82O85S8

    • Absent Amino Acids

    • LMT

    • Common Amino Acids

    • C

    • Mass

    • 6425.24

    • PI

    • 6.06

    • Basic Residues

    • 10

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +1

    • Boman Index

    • -135.46

    • Hydrophobicity

    • -0.928

    • Aliphatic Index

    • 40.88

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12990

    • Absorbance 280nm

    • 231.96

    • Polar Residues

    • 19

DRAMP03460

DRAMP03460 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds 11-39; 18-43; 26-38; 32-47 and one WAP Domain

Literature Information

  • ·Literature 1

    • Title

    • Genome sequence of the Brown Norway rat yields insights into mammalian evolution.

    • Reference

    • Genome sequence of the Brown Norway rat yields insights into mammalian evolution.

    • Author

    • Gibbs R.A, Weinstock G.M, Metzker M.L, Muzny D.M, Sodergren E.J, et al, Collins F.S.
  • ·Literature 2

    • Title

    • A genomic analysis of rat proteases and protease inhibitors.

    • Reference

    • Genome Res. 2004 Apr;14(4):609-622.

    • Author

    • Puente XS, López-Otín C.