General Information

    • DRAMP ID

    • DRAMP03461

    • Peptide Name

    • Defensin 5 (Enteric defensin; RD-5; Rodents, mammals, animals)

    • Source

    • Rattus norvegicus (Rat)

    • Family

    • Belongs to the alpha-defensin family

    • Gene

    • Not found

    • Sequence

    • LRDLKCFCRRKSCNWGEGIMGICKKRYGSPILCCR

    • Sequence Length

    • 35

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03461 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03461.

Physicochemical Information

    • Formula

    • C174H290N56O44S7

    • Absent Amino Acids

    • AHQTV

    • Common Amino Acids

    • C

    • Mass

    • 4094.99

    • PI

    • 9.55

    • Basic Residues

    • 9

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +7

    • Boman Index

    • -77.29

    • Hydrophobicity

    • -0.314

    • Aliphatic Index

    • 66.86

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 216.62

    • Polar Residues

    • 14

DRAMP03461

DRAMP03461 chydropathy plot

Comments Information

    • Function

    • Probably contributes to the antimicrobial barrier Function

    • Tissue specificity

    • Small intestine. Not present in heart, liver, spleen, kidney, large intestine and colon.

    • Induction

    • By hemorrhagic shock.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Induction of a rat enteric defensin gene by hemorrhagic shock.

    • Reference

    • Infect Immun. 1999 Sep;67(9):4787-4793.

    • Author

    • Condon MR, Viera A, D'Alessio M, Diamond G.