General Information

    • DRAMP ID

    • DRAMP03465

    • Peptide Name

    • Cicadin (Insects, animals)

    • Source

    • Cicada flammata

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • NEYHGFVDKANNENKRKKQQGRDDFVVKPNNFANRRRKDDYNENYYDDVDAADVV

    • Sequence Length

    • 55

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal, Antiviral

    • Target Organism

      • Fungi: Botrytis cinerea (MIC=100 nM), Mycosphaerella arachidicola (MIC=70 nM), Fusarium oxysporum (MIC=180 nM), Physalospora piricola (MIC=60 nM), Rhizoctonia solani, Coprinus comatus, HIV-1 reverse transcriptase.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03465 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03465.

Physicochemical Information

    • Formula

    • C283H427N89O95

    • Absent Amino Acids

    • CILMSTW

    • Common Amino Acids

    • DN

    • Mass

    • 6596.04

    • PI

    • 5.7

    • Basic Residues

    • 12

    • Acidic Residues

    • 12

    • Hydrophobic Residues

    • 13

    • Net Charge

    • 0

    • Boman Index

    • -240.57

    • Hydrophobicity

    • -1.753

    • Aliphatic Index

    • 38.91

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5960

    • Absorbance 280nm

    • 110.37

    • Polar Residues

    • 15

DRAMP03465

DRAMP03465 chydropathy plot

Comments Information

    • Function

    • Possesses antifungal activity against B.cinerea, M.arachidicola, F.oxysporum, R.solani and C.comatus. Suppresses the activity of HIV-1 reverse transcriptase and stimulates the proliferation of murine splenocytes.

Literature Information

  • ·Literature 1

    • Title

    • Isolation of cicadin, a novel and potent antifungal peptide from dried juvenile cicadas.

    • Reference

    • Peptides. 2002;23:7-11.

    • Author

    • Wang H, Ng TB.