• DRAMP ID

    • DRAMP03465
    • Peptide Name

    • Cicadin (Insects, animals)
    • Source

    • Cicada flammata
    • Family

    • Unknow
    • Gene

    • Unknow
    • Sequence

    • NEYHGFVDKANNENKRKKQQGRDDFVVKPNNFANRRRKDDYNENYYDDVDAADVV
    • Sequence Length

    • 55
    • Evidence code

    • Protein level
    • Biological Activity

    • Antifungal, Antiviral
    • Target Organism

      • Fungi: Botrytis cinerea (MIC=100 nM), Mycosphaerella arachidicola (MIC=70 nM), Fusarium oxysporum (MIC=180 nM), Physalospora piricola (MIC=60 nM), Rhizoctonia solani, Coprinus comatus, HIV-1 reverse transcriptase.
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Structure

    • Unknow
    • Structure Description

    • Unknow
    • PDB ID

    • Unknow
    • DRAMP03465 helical wheel diagram
    • Formula

    • C283H427N89O95
    • Absent Amino Acids

    • CILMSTW
    • Common Amino Acids

    • DN
    • Mass

    • 7559.42
    • PI

    • 5.81
    • Basic Residues

    • 12
    • Acidic Residues

    • 12
    • Hydrophobic Residues

    • 13
    • Boman Index

    • -240.57
    • Hydrophobicity

    • -175.27
    • Aliphatic Index

    • 38.91
    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5960
    • Absorbance 280nm

    • 110.37
    • Polar Residues

    • 15

DRAMP03465

DRAMP03465 chydropathy plot
    • Function

    • Possesses antifungal activity against B.cinerea, M.arachidicola, F.oxysporum, R.solani and C.comatus. Suppresses the activity of HIV-1 reverse transcriptase and stimulates the proliferation of murine splenocytes.
  • Literature 1
    • Reference

    • Peptides. 2002;23:7-11.
    • Author

    • Wang H, Ng TB.
    • Title

    • Isolation of cicadin, a novel and potent antifungal peptide from dried juvenile cicadas.