General Information

    • DRAMP ID

    • DRAMP03470

    • Peptide Name

    • Defensin-1 (American oyster defensin, AOD; molluscs, animals)

    • Source

    • Crassostrea virginica (American oyster)

    • Family

    • Belongs to the invertebrate defensin family (Type 2 subfamily)

    • Gene

    • Not found

    • Sequence

    • GFGCPWNRYQCHSHCRSIGRLGGYCAGSLRLTCTCYRS

    • Sequence Length

    • 38

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Lactococcus lactis subsp. lactis (MECs=2.4 µg/ml), Staphylococcus aureus (MECs=3 µg/ml);
      • Gram-negative bacteria: Escherichia coli D31 (MECs=7.6 µg/ml), Vibrio parahaemolyticus (MECs=15 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03470 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03470.

Physicochemical Information

    • Formula

    • C180H274N60O50S6

    • Absent Amino Acids

    • DEKMV

    • Common Amino Acids

    • CG

    • Mass

    • 4270.89

    • PI

    • 9.18

    • Basic Residues

    • 7

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +7

    • Boman Index

    • -75.14

    • Hydrophobicity

    • -0.363

    • Aliphatic Index

    • 43.68

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10345

    • Absorbance 280nm

    • 279.59

    • Polar Residues

    • 22

DRAMP03470

DRAMP03470 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bond

Literature Information

  • ·Literature 1

    • Title

    • Purification of a novel arthropod defensin from the American oyster, Crassostrea virginica.

    • Reference

    • Biochem Biophys Res Commun. 2005 Dec 30;338(4):1998-2004.

    • Author

    • Seo JK, Crawford JM, Stone KL, Noga EJ.