General Information

    • DRAMP ID

    • DRAMP03471

    • Peptide Name

    • Recombinant Crassostrea Gigas Defensin (Cg-Def; molluscs, animals)

    • Source

    • Crassostrea gigas (Pacific oyster)

    • Family

    • Not found

    • Gene

    • def

    • Sequence

    • GFGCPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKK

    • Sequence Length

    • 43

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-positive bacteria: Micrococcus lysodeikticus (MIC=0.005-0.01 µM), Staphylococcus aureus (MIC=1.25-2.5 µM), Microbacterium maritypicum (MIC=0.5-1 µM), Bacillus megaterium (MIC>20 µM);
      • Gram-negative bacteria: Escherichia coli 363 (MIC=35-20 µM), Vibrio alginolyticus (MIC>20 µM), Salmonella typhimurium (MIC>20 µM).
      • Fungi: Fusarium oxysporum (MIC=9-4.5 µM), Botrytis cinerea (MIC>20 µM), Penicillium crustosum (MIC>20 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid II

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys4 and Cys25,Cys11 and Cys34,Cys15 and Cys36,Cys20 and Cys39.

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03471 helical wheel diagram

    • PDB ID

    • 2B68 resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP03471.

Physicochemical Information

    • Formula

    • C190H303N61O59S8

    • Absent Amino Acids

    • EMV

    • Common Amino Acids

    • C

    • Mass

    • 4642.35

    • PI

    • 8.73

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +5

    • Boman Index

    • -75.53

    • Hydrophobicity

    • -0.412

    • Aliphatic Index

    • 43.26

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7490

    • Absorbance 280nm

    • 178.33

    • Polar Residues

    • 23

DRAMP03471

DRAMP03471 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Characterization of a defensin from the oyster Crassostrea gigas. Recombinant production, folding, solution structure, antimicrobial activities, and gene expression.

    • Reference

    • J Biol Chem. 2006 Jan 6;281(1):313-323.

    • Author

    • Gueguen Y, Herpin A, Aumelas A, Garnier J, Fievet J, Escoubas JM, Bulet P, Gonzalez M, Lelong C, Favrel P, Bachère E.