• • DRAMP ID

  • DRAMP03475

• • Peptide Name

  • Vicilin-like Antimicrobial peptide 2a (MiAMP2a; Plant defensin)

• • Source

  • Macadamia integrifolia (Macadamia nut)

• • Family

  • Belongs to the vicilin-like family

• • Gene

  • AMP2-3

• • Sequence

  • QCMQLETSGQMRRCVSQCDKRFEEDIDWSKYDNQE

• • Sequence Length

  • 35

• • UniProt Entry

  • Q9SPL3

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

• • Target Organism

  • • Gram-positive bacteria: (- Ca2+, + Ca2+): Clavibacter michiganensis (IC50=50, >50 µg/ml).
    • Fungi (- Ca2+, + Ca2+): Alternaria helianthi (IC50=5-10, ND µg/ml), Ceratocystis paradoxa (IC50=20-50, >50 µg/ml), Cercospora nicotianae (IC50=5-10, 5-10 µg/ml), Chalara elegans (IC50=2-5, 10-20 µg/ml), Fusarium oxysporum (IC50=10, 20-50 µg/ml), Leptosphaeria maculans (IC50=25, >50 µg/ml), Sclerotinia sclerotiorum (IC50=20-50, >50 µg/ml), Verticillium dahliae (IC50=5-10, >50 µg/ml), Saccharomyces cerevisiae (IC50=20-50, >50 µg/ml), Phytophthora cryptogea (IC50=5-10, 10-25 µg/ml), Phytophthora parasitica nicotianae (IC50=10-20, >50 µg/ml).
    • [NOTE:, Ca2+ = Medium with low content of CaCl2 (50 µM); + Ca2+ = Medium supplemented with high concentration of CaCl2 (1 mM)]

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP03475.

DRAMP03475

• • Comment

  • No comments found on DRAMP database

• ·Literature 1

• • Title

  • A family of antimicrobial peptides is produced by processing of a 7S globulin protein in Macadamia integrifolia kernels.

• • Pubmed ID

  • 10571855

• • Reference

  • Plant J. 1999 Sep;19(6):699-710.

• • Author

  • Marcus JP, Green JL, Goulter KC, Manners JM.