General Information

    • DRAMP ID

    • DRAMP03482

    • Peptide Name

    • Defensin-like protein 1 (Predicted; Insects, animals; Predicted)

    • Source

    • Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)

    • Family

    • Not found

    • Gene

    • Def1

    • Sequence

    • MGSKVYYVLMLALSFYVVQLCAFPRNSVAFEKQHESLPHADYIVTQKTESHEKTTAEPKLPGRIWCQYEEVTEDAICQEHCIPKGYSYGLCISNTCSCI

    • Sequence Length

    • 99

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03482 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03482.

Physicochemical Information

    • Formula

    • C502H769N127O150S9

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • ES

    • Mass

    • 11271.93

    • PI

    • 5.73

    • Basic Residues

    • 12

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 30

    • Net Charge

    • +1

    • Boman Index

    • -113.3

    • Hydrophobicity

    • -0.151

    • Aliphatic Index

    • 77.78

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 16305

    • Absorbance 280nm

    • 166.38

    • Polar Residues

    • 34

DRAMP03482

DRAMP03482 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Pyrosequencing the Manduca sexta larval midgut transcriptome: messages for digestion, detoxification and defence.

    • Reference

    • Insect Mol Biol. 2010 Feb;19(1):61-75.

    • Author

    • Pauchet Y, Wilkinson P, Vogel H, Nelson DR, Reynolds SE, Heckel DG, ffrench-Constant RH.