General Information

    • DRAMP ID

    • DRAMP03488

    • Peptide Name

    • Defense protein 4 (DFP-4; Insects, animals)

    • Source

    • Lonomia obliqua (Moth)

    • Family

    • Belongs to the cecropin family

    • Gene

    • Not found

    • Sequence

    • WDFLKELEGVGQRVRDSIISAGPAIDVLKKSQGPRRWSRP

    • Sequence Length

    • 40

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03488 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03488.

Physicochemical Information

    • Formula

    • C203H328N62O57

    • Absent Amino Acids

    • CHMNTY

    • Common Amino Acids

    • R

    • Mass

    • 4549.22

    • PI

    • 10.25

    • Basic Residues

    • 8

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +3

    • Boman Index

    • -99.05

    • Hydrophobicity

    • -0.655

    • Aliphatic Index

    • 85.25

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 11000

    • Absorbance 280nm

    • 282.05

    • Polar Residues

    • 8

DRAMP03488

DRAMP03488 chydropathy plot

Comments Information

    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • A catalog for the transcripts from the venomous structures of the caterpillar Lonomia obliqua: identification of the proteins potentially involved in the coagulation disorder and hemorrhagic syndrome.

    • Reference

    • Gene. 2005 Aug 1;355:11-27.

    • Author

    • Veiga AB, Ribeiro JM, Guimarães JA, Francischetti IM.